ALDH9A1 Antibody

Name ALDH9A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69138
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ALDH9A1
Conjugate Unconjugated
Supplier Page Shop

Product images