CLCN1 Antibody
| Name | CLCN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69124 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Rat |
| Antigen | Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CLCN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CLCN1 Antibody [NBP1-69124] - Lanes: 1: 20 ug mouse muscle membrane fraction, 2: Empty, 3: 20 ug mouse brain membrane fraction, 4: Empty, 5: 20 ug mouse muscle cytosolic fraction, 6: 20 ug mouse brain cytosolic fraction Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19454_CLCN1-Antibody-Western-Blot-NBP1-69124-img0003.jpg)
Western Blot: CLCN1 Antibody [NBP1-69124] - Lanes: 1: 20 ug mouse muscle membrane fraction, 2: Empty, 3: 20 ug mouse brain membrane fraction, 4: Empty, 5: 20 ug mouse muscle cytosolic fraction, 6: 20 ug mouse brain cytosolic fraction Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit
![Western Blot: CLCN1 Antibody [NBP1-69124] - Rat Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19455_CLCN1-Antibody-Western-Blot-NBP1-69124-img0002.jpg)
Western Blot: CLCN1 Antibody [NBP1-69124] - Rat Brain lysate, concentration 0.2-1 ug/ml.