ZER1 Antibody

Name ZER1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69105
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZER1 (zer-1 homolog (C. elegans)) The peptide sequence was selected from the middle region of ZER1. Peptide sequence LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZER1
Conjugate Unconjugated
Supplier Page Shop

Product images