RAP1GDS1 Antibody
| Name | RAP1GDS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69099 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAP1GDS1 (RAP1, GTP-GDP dissociation stimulator 1) The peptide sequence was selected from the middle region of RAP1GDS1. Peptide sequence LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAP1GDS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14426_RAP1GDS1-Antibody-Western-Blot-NBP1-69099-img0003.jpg)
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human lacenta Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14427_RAP1GDS1-Antibody-Western-Blot-NBP1-69099-img0001.jpg)
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human lacenta Lysate 1ug/ml Gel Concentration 12%
![Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14428_RAP1GDS1-Antibody-Western-Blot-NBP1-69099-img0002.jpg)
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
![Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Jurkat, Antibody Dilution: 1.0 ug/ml RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14429_RAP1GDS1%2520Antibody-Western%2520Blot-NBP1-69099-img0004.jpg)
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Jurkat, Antibody Dilution: 1.0 ug/ml RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.