RAB8B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69095
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Monkey
• Antigen: Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RAB8B
• Conjugate: Unconjugated