BBS2 Antibody

Name BBS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-69082
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BBS2 (Bardet-Biedl syndrome 2) The peptide sequence was selected from the N terminal of BBS2. Peptide sequence GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BBS2
Conjugate Unconjugated
Supplier Page Shop

Product images