NIR2 Antibody

Name NIR2 Antibody
Supplier Novus Biologicals
Catalog NBP1-69043
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSA
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Pitpnm1
Conjugate Unconjugated
Supplier Page Shop

Product images