LCoR Antibody

Name LCoR Antibody
Supplier Novus Biologicals
Catalog NBP1-69036
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LCOR (ligand dependent nuclear receptor corepressor) The peptide sequence was selected from the C terminal of LCOR. Peptide sequence EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LCOR
Conjugate Unconjugated
Supplier Page Shop

Product images