B4GALT6 Antibody

Name B4GALT6 Antibody
Supplier Novus Biologicals
Catalog NBP1-69019
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to B4galt6 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6) The peptide sequence was selected from the C terminal of B4galt6 (NP_062711). Peptide sequence GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRY
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene B4GALT6
Conjugate Unconjugated
Supplier Page Shop

Product images