Name | B4GALT6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69019 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic peptides corresponding to B4galt6 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6) The peptide sequence was selected from the C terminal of B4galt6 (NP_062711). Peptide sequence GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRY |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | B4GALT6 |
Conjugate | Unconjugated |
Supplier Page | Shop |