FGF14 Antibody

Name FGF14 Antibody
Supplier Novus Biologicals
Catalog NBP1-69006
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FGF14
Conjugate Unconjugated
Supplier Page Shop

Product images