COMMD2 Antibody

Name COMMD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-68999
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to Commd2 (COMM domain containing 2) The peptide sequence was selected from the middle region of Commd2. Peptide sequence SSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILNELAPRL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COMMD2
Conjugate Unconjugated
Supplier Page Shop

Product images