BNC1 Antibody

Name BNC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-68996
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BNC1
Conjugate Unconjugated
Supplier Page Shop

Product images