ABCA12 Antibody
| Name | ABCA12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69304 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to ABCA12(ATP-binding cassette, sub-family A (ABC1), member 12) The peptide sequence was selected from the middle region of ABCA12. Peptide sequence TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABCA12 |
| Supplier Page | Shop |
Product images
![Western Blot: ABCA12 Antibody [NBP1-69304] - This Anti-ABCA12 antibody was used in Western Blot of Fetal Stomach tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8603_ABCA12%2520Antibody-Western%2520Blot-NBP1-69304-img0001.jpg)
Western Blot: ABCA12 Antibody [NBP1-69304] - This Anti-ABCA12 antibody was used in Western Blot of Fetal Stomach tissue lysate at a concentration of 1ug/ml.