TBC1D19 Antibody

Name TBC1D19 Antibody
Supplier Novus Biologicals
Catalog NBP1-69202
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TBC1D19 (TBC1 domain family, member 19) The peptide sequence was selected from the middle region of TBC1D19. Peptide sequence PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TBC1D19
Conjugate Unconjugated
Supplier Page Shop

Product images