SCAMP3 Antibody

Name SCAMP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-69192
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SCAMP3 (secretory carrier membrane protein 3) The peptide sequence was selected from the N terminal of SCAMP3. Peptide sequence FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SCAMP3
Conjugate Unconjugated
Supplier Page Shop

Product images