HOXC12 Antibody

Name HOXC12 Antibody
Supplier Novus Biologicals
Catalog NBP1-69214
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HOXC12 (homeobox C12) The peptide sequence was selected from the C terminal of HOXC12. Peptide sequence NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HOXC12
Conjugate Unconjugated
Supplier Page Shop

Product images