MSTO1 Antibody

Name MSTO1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69212
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MSTO1 (misato homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of MSTO1. Peptide sequence YRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MSTO1
Conjugate Unconjugated
Supplier Page Shop

Product images