ARMC8 Antibody

Name ARMC8 Antibody
Supplier Novus Biologicals
Catalog NBP1-69203
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to ARMC8 (armadillo repeat containing 8) The peptide sequence was selected from the N terminal of ARMC8. Peptide sequence MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ARMC8
Supplier Page Shop

Product images