SLC43A3 Antibody
| Name | SLC43A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69535 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC43A3(solute carrier family 43, member 3) The peptide sequence was selected from the N terminal of SLC43A3. Peptide sequence MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC43A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC43A3 Antibody [NBP1-69535] - This Anti-SLC43A3 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 2.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24274_SLC43A3-Antibody-Western-Blot-NBP1-69535-img0001.jpg)
![Immunohistochemistry: SLC43A3 Antibody [NBP1-69535] - Staining of human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24275_SLC43A3-Antibody-Immunohistochemistry-NBP1-69535-img0002.jpg)