RHBG Antibody
| Name | RHBG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69483 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RHBG(Rh family, B glycoprotein) The peptide sequence was selected from the C terminal of RHBG. Peptide sequence LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RHBG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RHBG Antibody [NBP1-69483] - This Anti-RHBG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24296_RHBG-Antibody-Western-Blot-NBP1-69483-img0001.jpg)
Western Blot: RHBG Antibody [NBP1-69483] - This Anti-RHBG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry: RHBG Antibody [NBP1-69483] - Staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. RHBG Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24297_RHBG-Antibody-Immunohistochemistry-NBP1-69483-img0002.jpg)
Immunohistochemistry: RHBG Antibody [NBP1-69483] - Staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. RHBG Antibody concentration 5 ug/ml.