UXS1 Antibody
| Name | UXS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69617 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UXS1(UDP-glucuronate decarboxylase 1) The peptide sequence was selected from the middle region of UXS1. Peptide sequence LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UXS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UXS1 Antibody [NBP1-69617] - This Anti-UXS1 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15822_UXS1-Antibody-Western-Blot-NBP1-69617-img0001.jpg)
Western Blot: UXS1 Antibody [NBP1-69617] - This Anti-UXS1 antibody was used in Western Blot of OVCAR-3 tissue lysate at a concentration of 1ug/ml.