DNAJC1 Antibody

Name DNAJC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69608
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DNAJC1(DnaJ (Hsp40) homolog, subfamily C, member 1) The peptide sequence was selected from the C terminal of DNAJC1. Peptide sequence ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC1
Conjugate Unconjugated
Supplier Page Shop

Product images