MDG1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69578
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DNAJB9(DnaJ (Hsp40) homolog, subfamily B, member 9) The peptide sequence was selected from the N terminal of DNAJB9. Peptide sequence MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DNAJB9
• Conjugate: Unconjugated