REEP1 Antibody
| Name | REEP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69643 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the C terminal of REEP1. Peptide sequence ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | REEP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: REEP1 Antibody [NBP1-69643] - This Anti-REEP1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7151_REEP1-Antibody-Western-Blot-NBP1-69643-img0001.jpg)
![Western Blot: REEP1 Antibody [NBP1-69643] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7152_REEP1%2520Antibody-Western%2520Blot-NBP1-69643-img0002.jpg)