PIGT Antibody
| Name | PIGT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69642 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the C terminal of PIGT. Peptide sequence LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIGT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PIGT Antibody [NBP1-69642] - This Anti-PIGT antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7160_PIGT-Antibody-Western-Blot-NBP1-69642-img0001.jpg)
![Western Blot: PIGT Antibody [NBP1-69642] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7161_PIGT%2520Antibody-Western%2520Blot-NBP1-69642-img0002.jpg)