GALNT13 Antibody
| Name | GALNT13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69624 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GALNT13 The peptide sequence was selected from the N terminal of GALNT13 (NP_443149). Peptide sequence CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GALNT13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GALNT13 Antibody [NBP1-69624] - This Anti-GALNT13 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16690_GALNT13%2520Antibody-Western%2520Blot-NBP1-69624-img0001.jpg)
Western Blot: GALNT13 Antibody [NBP1-69624] - This Anti-GALNT13 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.