SLC13A3/NaDC3 Antibody
| Name | SLC13A3/NaDC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69630 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the N terminal of SLC13A3 (NP_073740). Peptide sequence MAVYWCTEALPLSVTALLPIVLFPFMGILPS |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC13A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630] - This Anti-SLC13A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15346_SLC13A3-NaDC3-Antibody-Western-Blot-NBP1-69630-img0001.jpg)
Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630] - This Anti-SLC13A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.