Name | SLC13A3/NaDC3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69630 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the N terminal of SLC13A3 (NP_073740). Peptide sequence MAVYWCTEALPLSVTALLPIVLFPFMGILPS |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SLC13A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |