DNAJC19 Antibody

Name DNAJC19 Antibody
Supplier Novus Biologicals
Catalog NBP1-68991
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC19
Conjugate Unconjugated
Supplier Page Shop

Product images