Acidic Calponin Antibody

Name Acidic Calponin Antibody
Supplier Novus Biologicals
Catalog NBP1-68944
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CNN3 (calponin 3, acidic) The peptide sequence was selected from the C terminal of CNN3. Peptide sequence GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNN3
Conjugate Unconjugated
Supplier Page Shop

Product images