Name | COL9A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68937 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | COL9A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |