COL9A3 Antibody

Name COL9A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-68937
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COL9A3
Conjugate Unconjugated
Supplier Page Shop

Product images