OSGIN2 Antibody

Name OSGIN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-68933
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OSGIN2 (oxidative stress induced growth inhibitor family member 2) The peptide sequence was selected from the C terminal of OSGIN2. Peptide sequence ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OSGIN2
Conjugate Unconjugated
Supplier Page Shop

Product images