Name | DHRS7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68913 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic peptides corresponding to Dhrs7 (dehydrogenase/reductase (SDR family) member 7) The peptide sequence was selected from the N terminal of Dhrs7. Peptide sequence MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | DHRS7 |
Conjugate | Unconjugated |
Supplier Page | Shop |