DHRS7 Antibody

Name DHRS7 Antibody
Supplier Novus Biologicals
Catalog NBP1-68913
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Dhrs7 (dehydrogenase/reductase (SDR family) member 7) The peptide sequence was selected from the N terminal of Dhrs7. Peptide sequence MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHRS7
Conjugate Unconjugated
Supplier Page Shop

Product images