B3GAT2 Antibody

Name B3GAT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-68910
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Bovine, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene B3gat2
Supplier Page Shop

Product images