Name | B3GAT2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68910 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Bovine, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | B3gat2 |
Supplier Page | Shop |