GODZ Antibody

Name GODZ Antibody
Supplier Novus Biologicals
Catalog NBP1-68903
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZDHHC3 (zinc finger, DHHC-type containing 3) The peptide sequence was selected from the C terminal of ZDHHC3. Peptide sequence MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZDHHC3
Conjugate Unconjugated
Supplier Page Shop

Product images