Name | RGL3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68976 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RGL3 (ral guanine nucleotide dissociation stimulator-like 3) The peptide sequence was selected from the middle region of RGL3. Peptide sequence RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RGL3 |
Conjugate | Unconjugated |
Supplier Page | Shop |