| Name | RGL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-68976 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RGL3 (ral guanine nucleotide dissociation stimulator-like 3) The peptide sequence was selected from the middle region of RGL3. Peptide sequence RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RGL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |