EVI2A Antibody

Name EVI2A Antibody
Supplier Novus Biologicals
Catalog NBP1-68926
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EVI2A (ecotropic viral integration site 2A) The peptide sequence was selected from the C terminal of EVI2A. Peptide sequence LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EVI2A
Conjugate Unconjugated
Supplier Page Shop

Product images