CNIH Antibody

Name CNIH Antibody
Supplier Novus Biologicals
Catalog NBP1-68915
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNIH1
Conjugate Unconjugated
Supplier Page Shop

Product images