CLGN Antibody

Name CLGN Antibody
Supplier Novus Biologicals
Catalog NBP1-62547
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLGN(calmegin) The peptide sequence was selected from the N terminal of CLGN. Peptide sequence YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene CLGN
Conjugate Unconjugated
Supplier Page Shop

Product images