PLP2 Antibody

Name PLP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-62539
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PLP2(proteolipid protein 2 (colonic epithelium-enriched)) The peptide sequence was selected from the middle region of PLP2. Peptide sequence LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PLP2
Conjugate Unconjugated
Supplier Page Shop

Product images