Name | PLP2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62539 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PLP2(proteolipid protein 2 (colonic epithelium-enriched)) The peptide sequence was selected from the middle region of PLP2. Peptide sequence LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | PLP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |