RDH10 Antibody

Name RDH10 Antibody
Supplier Novus Biologicals
Catalog NBP1-62636
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RDH10(retinol dehydrogenase 10 (all-trans)) The peptide sequence was selected from the N terminal of RDH10. Peptide sequence QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RDH10
Conjugate Unconjugated
Supplier Page Shop

Product images