QPCTL Antibody

Name QPCTL Antibody
Supplier Novus Biologicals
Catalog NBP1-62586
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to QPCTL(glutaminyl-peptide cyclotransferase-like) The peptide sequence was selected from the middle region of QPCTL. Peptide sequence QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene QPCTL
Conjugate Unconjugated
Supplier Page Shop

Product images