Hyaluronan Synthase 3/HAS3 Antibody

Name Hyaluronan Synthase 3/HAS3 Antibody
Supplier Novus Biologicals
Catalog NBP1-62552
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HAS3(hyaluronan synthase 3), The peptide sequence was selected from the C terminal of HAS3. Peptide sequence SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HAS3
Conjugate Unconjugated
Supplier Page Shop

Product images