PM20D2 Antibody

Name PM20D2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70678
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PM20D2(peptidase M20 domain containing 2) The peptide sequence was selected from the middle region of PM20D2. Peptide sequence HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PM20D2
Conjugate Unconjugated
Supplier Page Shop

Product images