NT5DC2 Antibody
| Name | NT5DC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70660 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NT5DC2 (5'-nucleotidase domain containing 2) The peptide sequence was selected from the N terminal of NT5DC2. Peptide sequence IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NT5DC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NT5DC2 Antibody [NBP1-70660] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24506_NT5DC2-Antibody-Western-Blot-NBP1-70660-img0004.jpg)
![Western Blot: NT5DC2 Antibody [NBP1-70660] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24507_NT5DC2-Antibody-Western-Blot-NBP1-70660-img0002.jpg)
![Western Blot: NT5DC2 Antibody [NBP1-70660] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24508_NT5DC2-Antibody-Western-Blot-NBP1-70660-img0003.jpg)