Nephronectin Antibody
| Name | Nephronectin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70658 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NPNT(nephronectin) The peptide sequence was selected from the middle region of NPNT. Peptide sequence TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NPNT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Nephronectin Antibody [NBP1-70658] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7126_Nephronectin-Antibody-Western-Blot-NBP1-70658-img0003.jpg)
![Western Blot: Nephronectin Antibody [NBP1-70658] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7127_Nephronectin-Antibody-Western-Blot-NBP1-70658-img0002.jpg)