MYBPC2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70646
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MYBPC2(myosin binding protein C, fast type) The peptide sequence was selected from the N terminal of MYBPC2. Peptide sequence KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MYBPC2
• Conjugate: Unconjugated