MFF Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70638
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to C2ORF33 The peptide sequence was selected from the C terminal of C2ORF33 (NP_064579). Peptide sequence VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MFF
• Conjugate: Unconjugated

Product images

Western Blot: MFF Antibody [NBP1-70638] - Human Muscle lysate, concentration 0.2-1 ug/ml.