MFAP3L Antibody

Name MFAP3L Antibody
Supplier Novus Biologicals
Catalog NBP1-70637
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MFAP3L(microfibrillar-associated protein 3-like) The peptide sequence was selected from the N terminal of MFAP3L. Peptide sequence MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene MFAP3L
Conjugate Unconjugated
Supplier Page Shop

Product images