Matrilin-1 Antibody
| Name | Matrilin-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70634 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MATN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Matrilin-1 Antibody [NBP1-70634] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7026_Matrilin-1-Antibody-Western-Blot-NBP1-70634-img0002.jpg)
Western Blot: Matrilin-1 Antibody [NBP1-70634] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: Matrilin-1 Antibody [NBP1-70634] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: OVCAR-3 cell lysate MATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7027_Matrilin-1%2520Antibody-Western%2520Blot-NBP1-70634-img0003.jpg)
Western Blot: Matrilin-1 Antibody [NBP1-70634] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: OVCAR-3 cell lysate MATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.