MAP7D1 Antibody

Name MAP7D1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70632
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAP7D1(MAP7 domain containing 1) The peptide sequence was selected from the N terminal of MAP7D1. Peptide sequence RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAP7D1
Conjugate Unconjugated
Supplier Page Shop

Product images